PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00031520-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 29643.9 Da    PI: 7.8265
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00031520-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.62.5e-261261251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      +ien +nrqvtfskR++g+ KKA+ELS+LC+aeva+iifss+gk yeyss
  PSME_00031520-RA 12 KIENLTNRQVTFSKRKAGLKKKAKELSILCGAEVALIIFSSSGKHYEYSS 61
                      69**********************************************96 PP

2K-box42.82.3e-151041613188
             K-box  31 LqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                       L r  Rh  GedLesLs++eLq+Le+qLe   +++R+k+ +l  e+++ + +  +e +
  PSME_00031520-RA 104 LHRVFRHTTGEDLESLSVNELQNLEDQLEIVTSRVRKKRFQLTQEKLKAMTEEVEESR 161
                       67788************************************99988877766555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.006363IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-38362IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-31484IPR002100Transcription factor, MADS-box
CDDcd002652.01E-41481No hitNo description
PRINTSPR004048.5E-27525IPR002100Transcription factor, MADS-box
PfamPF003192.4E-241259IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-272540IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-274061IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.85687176IPR002487Transcription factor, K-box
PfamPF014864.7E-12104159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MRMGRGKIEI RKIENLTNRQ VTFSKRKAGL KKKAKELSIL CGAEVALIIF SSSGKHYEYS  60
SPCSSIEQIL EKYMTVSGSK LGEDQINTFM GGCVVKDDID FVGLHRVFRH TTGEDLESLS  120
VNELQNLEDQ LEIVTSRVRK KRFQLTQEKL KAMTEEVEES RRRLRYYEGF QEKKNDLYMF  180
SDCRGLGETV DDYPFCQLKD KNPIYLTSSA AVPPVLPVPP RLHETDYQYL DLQLGHSTNL  240
KTCPHLDLQL GYNTDMKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-17473168Myocyte-specific enhancer factor 2A
3mu6_B1e-17473168Myocyte-specific enhancer factor 2A
3mu6_C1e-17473168Myocyte-specific enhancer factor 2A
3mu6_D1e-17473168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9XGJ43e-42GGM13_GNEGN; MADS-box protein GGM13
TrEMBLQ9SEE01e-137Q9SEE0_PICAB; MADS-box transcription factor
STRINGGSMUA_Achr2P02660_0012e-37(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26310.14e-32MIKC_MADS family protein